Similar sites like familypethosp.com and alternatives

New Conveniences for Pet Family Pet Hospital, LLC - Voted Best Veterinarian in Platteville, WI. We treat your pets like they are one of the

Topics: family pet hospital topeka ks,family pet hospital of stone oak,family pet hospital clovis ca,family pet hospital chilliwack,family pet hospital ashland ma,family pet hospital,family pet hospital vacaville,familypethosp.vetsfirstchoice.com

Semrush Rank: 1,378,096 Est. Website Worth: $ 19,250

Sites similar to familypethosp.com - Top 19 familypethosp.com alternatives

familybyfamily.org.au

Title: Home - Family by
Description: A program built by families for A program built by families for families. We link families up with other families to support them and enable them to make the changes they want in their
Semrush Rank: 6,770,462 Website Worth: $ 4,400
Topic: family by family,family by family stoke,family by family adelaide,family by family australia,family by family uk,family by family tacsi,family by family uniting communities,family by family program adelaide

Is it similar? Yes 0 No 0

thefamilypet.org

Title: Veterinary The Family Pet Veterinary Hospital veterinarian Pet
Description: Testimonials Ballard based Seattle full-service veterinary clinic comprised of a modern hospital, surgical, radiology, laboratory, pharmacy, and grooming
Keywords: veterinary, animal doctor, pet doctor, vet near me, veterinarian
Semrush Rank: 848,503 Website Worth: $ 31,350
Topic: the family pet,the family pet store,the family et al,the family pet clinic,the family pet boutique,the family pet vet,the family pet ballard,the family pet vet berryville ar

Is it similar? Yes 0 No 0

thefamilypethospital.com

Title: Top Rated Local Veterinarians – The Family Pet Hospital Laser and Wellness
Description: Welcome to our practice! Let us know how we can help The Family Pet Hospital Laser and Wellness Center has been taking care of local pets in Ashland since 1998. We are your local
Semrush Rank: 1,180,311 Website Worth: $ 22,550
Topic: the family pet hospital ashland,the family pet hospital ma,the family pet hospital,the family pet hospital ashland ma,the family pet hospital seattle

Is it similar? Yes 0 No 0

familypethealthctr.com

Title: Veterinarian in Mattawan | Vet Near You | Family Pet Health
Description: Because Family Means The Toggle Navigation 269-668-5900 Pharmacy Clinic App Portal Menu Home About Team Gallery of Pets Careers Services Wellness Dental Surgery Pain Management Re
Semrush Rank: 413,503 Website Worth: $ 63,800
Topic: family pet health center mattawan,family pet health center mishawaka ave,family pet health center,family pet health center south bend in,family pet health care,family pet health center mattawan mi,family pet health center mishawaka,family pet health care decatur al

Is it similar? Yes 0 No 0

familypetvacaville.com

Title: Veterinarian in Vacaville, CA | Family Pet
Description: We Welcome New Veterinarian in Vacaville, CA - Family Pet Hospital is an affordable skilled Veterinarian in Vacaville, CA. Accepting new appointments. Call today or request an appointment on our
Semrush Rank: 1,411,179 Website Worth: $ 18,700
Topic: family pet vet berryville ar,family pet villebarou,family pet vet athol,family pet veterinary,family pet veterinary hospital,family pet vet,family pet vacaville,family pet veterinary practice,familypetveterinaryclinic.vetsfirstchoice.com

Is it similar? Yes 0 No 0

familyanimalhospital.ca

Title: Family Animal
Description: HONEST QUALITY Based in Costa Mesa, California, Family Animal Hospital have been providing animal and pet veterinary services since
Keywords: family animal hospital, family animal hospital california, animal veterinary services, pet veterinary services, animal vet costa mesa
Semrush Rank: 1,533,304 Website Worth: $ 17,600
Topic: family animal hospital costa mesa,family animal hospital riverview fl,family animal hospital friendswood tx,family animal hospital of friendswood,family animal hospital fl,family animal hospital batavia ohio,family animal hospital,family animal hospital friendswood

Is it similar? Yes 0 No 0

familypetandaquarium.com

Title: Family Pet and Aquarium ::
Description: Welcome! We have puppies, kittens, fish, feeders, small animals, and
Keywords: pet, supplies, puppy, puppies, kitten, birds, fish
Semrush Rank: 674,662 Website Worth: $ 39,050
Topic: family pet and aquarium nh,family pet and aquarium nashua nh,family pet and aquarium,family pet and aquarium review,family pet and aquarium nashua,family pet and aquarium marshall,family pet and aquarium geelong

Is it similar? Yes 0 No 0

familyandpethealth.com

Title: Family & Pet Health – Family & Pet
Description: +44 (0) 7537 105 320 (9 am - 5 pm - Mon - Fri) Sign in or Create an Account Search Cart 0 Menu Cart 0 Search HOME BRANDS Aerobic Life Alovitox Amate Life
Semrush Rank: 11,266,111 Website Worth: $ 2,750
Topic: family and pet pajamas,family and pet pjs,family and pet health,family and pet christmas pajamas,family and pet matching pajamas,family and pets,family and pet portraits,family and pet friendly resorts,family and pet photography

Is it similar? Yes 0 No 0

familypethealth.com

Title: Murfreesboro, TN Veterinarian 37127 | Family Pet
Description: A veterinary experience you and your pet will At Family Pet Health, our team is here to help your pet live their healthiest life. A trip to the vet does not have to be
Semrush Rank: 1,093,671 Website Worth: $ 24,200
Topic: family pet health center mattawan,family pet health mattawan mi,family pet health murfreesboro tn,family pet health center,family pet health,family pet health care,family pet health center mishawaka ave,family pet health mishawaka

Is it similar? Yes 0 No 0

familypetclinic.org

Title: Veterinarian in Menomonee Falls, WI | Family Pet
Description: Veterinarian Services Near Menomonee Falls, Are you looking for a veterinarian office near Menomonee Falls, WI? Learn more about how Family Pet Clinic can assist your family
Keywords: Veterinary Clinic, Pet Vaccines, Pet Health/Wellness, Pet Surgical, Pet Dental Services, Pet Grooming
Semrush Rank: 1,073,009 Website Worth: $ 24,750
Topic: family pet clinic newberg,family pet clinic of newberg,family pet clinic menomonee falls,family pet clinic southampton pa,family pet clinic nrh,family pet clinic,family pet clinic temple tx,family pet clinic redondo beach

Is it similar? Yes 0 No 0

familyspetcremation.com

Title: Family’s Pet Cremation | Pet Cremation Arlington Heights
Description: Small & Large Animal Cremation & Equine cremation. Pet crematory. Walk in & Pick up Service Call
Semrush Rank: 0 Website Worth: $ 500
Topic: family's pet cremation,family pet cremation birmingham,family pet cremation arlington heights,family's pet cremation arlington heights il,family pet cremation alabama,family pet cremation spokane,family pet cremation services,family pet cremation saskatoon

Is it similar? Yes 0 No 0

familydentisttoledo.com

Title: Hires Dental Care | Cosmetic Dentist | Toledo,
Description: Dentist - Toledo, Visit local dentist Dr. J Eric Hires in Toledo, OH for family and cosmetic dentistry. Offering dental implants, porcelain veneers, tooth cleanings &
Semrush Rank: 860,726 Website Worth: $ 30,800
Topic: family dentist topeka ks,family dentist toms river nj,family dentistry topeka,family dentist townsend ma,family dentistry topeka ks,family dentistry torrington wy,family dentistry toms river,family dentistry torrington ct

Is it similar? Yes 0 No 0

familypetmedical.net

Title: Veterinarian in Arlington, WA | Family Pet Medical &
Description: Family Pet Medical & Surgery is a skilled Veterinarian in Arlington, WA. Accepting new appointments. Call today or request an appointment on our
Semrush Rank: 1,640,054 Website Worth: $ 16,500
Topic: family pet medical and surgery,family pet medical center fort dodge iowa,family pet medical & surgery,family pet medical center,family pet medical center ft lauderdale,familypetmedical hotmail.com,family pet medical arlington,family pet medical

Is it similar? Yes 0 No 0

familypetclinic.net

Title: Gainesville GA Area
Description: Family Pet Welcome to Family Pet Clinic, a veterinary clinic helping you take care of your dog and cat family members. A vet who encourages preventative health care, and offers veterinary surgery and medicine for your pets. Vet hospital taking card of small
Keywords: veterinary, pet clinic, animal hospital, veterinarian, Gainesville GA, Oakwood GA, Family Pet Clinic, vet clinic
Semrush Rank: 3,931,114 Website Worth: $ 7,150
Topic: family pet clinic redondo beach,family pet clinic newberg,family pet clinic nrh,family pet clinic menomonee falls,family pet clinic southampton pa,family pet clinic,family pet clinic temple tx,family pet clinic of newberg

Is it similar? Yes 0 No 0

hansenfamilyhospital.com

Title: Hansen Family Hospital | Iowa Falls,
Description: Hansen Family Hospital is a municipally-owned Critical Access Hospital located in the community of Iowa Falls. Learn more
Semrush Rank: 0 Website Worth: $ 500
Topic: hansen family hospital iowa falls iowa,hansen family hospital iowa falls ia,hansen family hospital er,hansen family hospital ia,hansen family hospital,hansen family hospital iowa,hansen family hospital iowa falls,hansen family hospital lab

Is it similar? Yes 0 No 0

tallgrasstopeka.com

Title: Domain Default
Description: If you are seeing this message, the website for is not available at this time. If you are the owner of this website, one of the following things may be oc
Semrush Rank: 0 Website Worth: $ 500
Topic: tallgrass topeka,tallgrass topeka ks family medicine,tallgrass topeka kansas,tallgrass topeka ks,tallgrass topeka ks radiology,tallgrass topeka ks doctors

Is it similar? Yes 0 No 0

belviderefamilypet.com

Title: Belvidere Family Pet Hospital – We treat your pet like our
Description: The finest in veterinary (815) 544-9930 [email protected] Mon - Fri : 8:00 AM - 5:30 PM | Sat 8:00 AM - 12:00 PM Search for: Home Your Hospital FAQs Contact Appointment The finest
Semrush Rank: 0 Website Worth: $ 500
Topic: belvidere family pet clinic belvidere il,belvidere family pet clinic,belvidere family pet hospital,belvidere family pet clinic il,belvidere family pet,belvidere family pet hospital belvidere il

Is it similar? Yes 0 No 0

familypetshospital.com

Title: Home - Family Pet Hospital - Quality Affordable Pet Care at Your
Description: Family Pet Hospital Perry Hall | We are a state of the art preventative care veterinary hospital serving Perry Hall, White Marsh, and surrounding
Semrush Rank: 784,253 Website Worth: $ 33,550
Topic: family pet hospital topeka ks,family pet hospital of stone oak,family pet hospital clovis ca,family pet hospital chilliwack,family pet hospital ashland ma,family pet hospital,family pet hospital vacaville

Is it similar? Yes 0 No 0

familypetservices.info

Title: Family Pet Services Inc. – Country Club For
Description: Welcome to CLUB 289-242-7986 Menu Home About Us News & Events Services & Rates Boarding Day Care Training Spa Services Additional Services VIP Services Club FPS Membershi
Semrush Rank: 5,315,663 Website Worth: $ 4,950
Topic: family pet services tucson az,family pet services milton,family pet services,family pet services campbellville,family pet services guelph,family pet services inc,family pet services guelph line,family pet services tucson

Is it similar? Yes 0 No 0

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

4 (times) 5

I'm sure it's similar Yes

What is website-like.com?

website-like.com is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
"Similar sites like" first finds the best and top keywords for all websites and rank them.

Some random sites

google.com

target.com

Similar sites like familypethosp.com and alternatives

Sites similar to familypethosp.com - Top 19 familypethosp.com alternatives

Latest 5

Top 5

Most 5

Some random sites